DIDO1,BYE1
  • DIDO1,BYE1

Anti-DIDO1 Antibody 25ul

Ref: AN-HPA049904-25ul
Anti-DIDO1

Información del producto

Polyclonal Antibody against Human DIDO1, Gene description: death inducer-obliterator 1, Alternative Gene Names: BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333, Validated applications: IHC, WB, Uniprot ID: Q9BTC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DIDO1
Gene Description death inducer-obliterator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ
Immunogen PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTC0
HTS Code 3002150000
Gene ID 11083
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DIDO1 Antibody 25ul

Anti-DIDO1 Antibody 25ul