ICAM3,CD50,CDW50
  • ICAM3,CD50,CDW50

Anti-ICAM3 Antibody 100ul

Ref: AN-HPA049820-100ul
Anti-ICAM3

Información del producto

Polyclonal Antibody against Human ICAM3, Gene description: intercellular adhesion molecule 3, Alternative Gene Names: CD50, CDW50, ICAM-R, Validated applications: ICC, Uniprot ID: P32942, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ICAM3
Gene Description intercellular adhesion molecule 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT
Immunogen AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD50, CDW50, ICAM-R
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P32942
HTS Code 3002150000
Gene ID 3385
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ICAM3 Antibody 100ul

Anti-ICAM3 Antibody 100ul