SSUH2,C3orf32
  • SSUH2,C3orf32

Anti-SSUH2 Antibody 100ul

Ref: AN-HPA049777-100ul
Anti-SSUH2

Información del producto

Polyclonal Antibody against Human SSUH2, Gene description: ssu-2 homolog (C. elegans), Alternative Gene Names: C3orf32, fls485, ssu-2, Validated applications: IHC, Uniprot ID: Q9Y2M2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SSUH2
Gene Description ssu-2 homolog (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AKAKGENLFKDENSVVYPIVDFPLRDISLASQRGIAEHSAALASRARVLQQRQTIELIPLTEVHYWYQGKTYVYYIYGTDHQVYAVDYPERYCCGCT
Immunogen AKAKGENLFKDENSVVYPIVDFPLRDISLASQRGIAEHSAALASRARVLQQRQTIELIPLTEVHYWYQGKTYVYYIYGTDHQVYAVDYPERYCCGCT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf32, fls485, ssu-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2M2
HTS Code 3002150000
Gene ID 51066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SSUH2 Antibody 100ul

Anti-SSUH2 Antibody 100ul