ATP13A1,ATP13A
  • ATP13A1,ATP13A

Anti-ATP13A1 Antibody 25ul

Ref: AN-HPA049717-25ul
Anti-ATP13A1

Información del producto

Polyclonal Antibody against Human ATP13A1, Gene description: ATPase type 13A1, Alternative Gene Names: ATP13A, CGI-152, FLJ31858, KIAA1825, Validated applications: IHC, Uniprot ID: Q9HD20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ATP13A1
Gene Description ATPase type 13A1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK
Immunogen YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATP13A, CGI-152, FLJ31858, KIAA1825
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HD20
HTS Code 3002150000
Gene ID 57130
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ATP13A1 Antibody 25ul

Anti-ATP13A1 Antibody 25ul