KNL1,AF15Q14,CASC5
  • KNL1,AF15Q14,CASC5

Anti-KNL1 Antibody 100ul

Ref: AN-HPA049647-100ul
Anti-KNL1

Información del producto

Polyclonal Antibody against Human KNL1, Gene description: kinetochore scaffold 1, Alternative Gene Names: AF15Q14, CASC5, CT29, D40, hKNL-1, hSpc105, KIAA1570, MCPH4, PPP1R55, Spc7, Validated applications: ICC, Uniprot ID: Q8NG31, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KNL1
Gene Description kinetochore scaffold 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQ
Immunogen DVTKQVIQTHVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAHNDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFLPRLPNKRNCSVTGIDDLEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF15Q14, CASC5, CT29, D40, hKNL-1, hSpc105, KIAA1570, MCPH4, PPP1R55, Spc7
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NG31
HTS Code 3002150000
Gene ID 57082
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KNL1 Antibody 100ul

Anti-KNL1 Antibody 100ul