ZNF142,KIAA0236
  • ZNF142,KIAA0236

Anti-ZNF142 Antibody 25ul

Ref: AN-HPA049594-25ul
Anti-ZNF142

Información del producto

Polyclonal Antibody against Human ZNF142, Gene description: zinc finger protein 142, Alternative Gene Names: KIAA0236, pHZ-49, Validated applications: ICC, IHC, Uniprot ID: P52746, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF142
Gene Description zinc finger protein 142
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPSPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLL
Immunogen RHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPSPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0236, pHZ-49
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52746
HTS Code 3002150000
Gene ID 7701
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF142 Antibody 25ul

Anti-ZNF142 Antibody 25ul