PCIF1,bA465L10.1
  • PCIF1,bA465L10.1

Anti-PCIF1 Antibody 100ul

Ref: AN-HPA049517-100ul
Anti-PCIF1

Información del producto

Polyclonal Antibody against Human PCIF1, Gene description: PDX1 C-terminal inhibiting factor 1, Alternative Gene Names: bA465L10.1, C20orf67, PPP1R121, Validated applications: ICC, IHC, Uniprot ID: Q9H4Z3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PCIF1
Gene Description PDX1 C-terminal inhibiting factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR
Immunogen SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA465L10.1, C20orf67, PPP1R121
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4Z3
HTS Code 3002150000
Gene ID 63935
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PCIF1 Antibody 100ul

Anti-PCIF1 Antibody 100ul