EMC8,C16orf2
  • EMC8,C16orf2

Anti-EMC8 Antibody 25ul

Ref: AN-HPA049476-25ul
Anti-EMC8

Información del producto

Polyclonal Antibody against Human EMC8, Gene description: ER membrane protein complex subunit 8, Alternative Gene Names: C16orf2, C16orf4, COX4NB, FAM158B, NOC4, Validated applications: ICC, IHC, Uniprot ID: O43402, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EMC8
Gene Description ER membrane protein complex subunit 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
Immunogen VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C16orf2, C16orf4, COX4NB, FAM158B, NOC4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43402
HTS Code 3002150000
Gene ID 10328
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-EMC8 Antibody 25ul

Anti-EMC8 Antibody 25ul