SF3A2,Prp11,PRPF11
  • SF3A2,Prp11,PRPF11

Anti-SF3A2 Antibody 25ul

Ref: AN-HPA049439-25ul
Anti-SF3A2

Información del producto

Polyclonal Antibody against Human SF3A2, Gene description: splicing factor 3a, subunit 2, 66kDa, Alternative Gene Names: Prp11, PRPF11, SAP62, SF3a66, Validated applications: ICC, IHC, WB, Uniprot ID: Q15428, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SF3A2
Gene Description splicing factor 3a, subunit 2, 66kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
Immunogen SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Prp11, PRPF11, SAP62, SF3a66
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15428
HTS Code 3002150000
Gene ID 8175
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SF3A2 Antibody 25ul

Anti-SF3A2 Antibody 25ul