NOB1,ART-4,MST158
  • NOB1,ART-4,MST158

Anti-NOB1 Antibody 100ul

Ref: AN-HPA049430-100ul
Anti-NOB1

Información del producto

Polyclonal Antibody against Human NOB1, Gene description: NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), Alternative Gene Names: ART-4, MST158, NOB1P, PSMD8BP1, Validated applications: IHC, Uniprot ID: Q9ULX3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NOB1
Gene Description NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PSNIKQIQQELEQCDVPEDVRVGCLTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTTSDMSRVFCSHCGNKTLKKVSVTVSDDGTLHMHFSR
Immunogen PSNIKQIQQELEQCDVPEDVRVGCLTTDFAMQNVLLQMGLHVLAVNGMLIREARSYILRCHGCFKTTSDMSRVFCSHCGNKTLKKVSVTVSDDGTLHMHFSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ART-4, MST158, NOB1P, PSMD8BP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULX3
HTS Code 3002150000
Gene ID 28987
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NOB1 Antibody 100ul

Anti-NOB1 Antibody 100ul