DOCK6,KIAA1395,ZIR1
  • DOCK6,KIAA1395,ZIR1

Anti-DOCK6 Antibody 25ul

Ref: AN-HPA049423-25ul
Anti-DOCK6

Información del producto

Polyclonal Antibody against Human DOCK6, Gene description: dedicator of cytokinesis 6, Alternative Gene Names: KIAA1395, ZIR1, Validated applications: ICC, IHC, WB, Uniprot ID: Q96HP0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DOCK6
Gene Description dedicator of cytokinesis 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL
Immunogen LYLPLLSIARDTLPRLHDFAEGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGCALSAESSRTLLACVLWVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1395, ZIR1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96HP0
HTS Code 3002150000
Gene ID 57572
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DOCK6 Antibody 25ul

Anti-DOCK6 Antibody 25ul