FBXO46,20D7-FC4
  • FBXO46,20D7-FC4

Anti-FBXO46 Antibody 100ul

Ref: AN-HPA049390-100ul
Anti-FBXO46

Información del producto

Polyclonal Antibody against Human FBXO46, Gene description: F-box protein 46, Alternative Gene Names: 20D7-FC4, Fbx46, FBXO34L, Validated applications: ICC, IHC, Uniprot ID: Q6PJ61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FBXO46
Gene Description F-box protein 46
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG
Immunogen YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 20D7-FC4, Fbx46, FBXO34L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PJ61
HTS Code 3002150000
Gene ID 23403
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FBXO46 Antibody 100ul

Anti-FBXO46 Antibody 100ul