MVB12B,C9orf28
  • MVB12B,C9orf28

Anti-MVB12B Antibody 100ul

Ref: AN-HPA049383-100ul
Anti-MVB12B

Información del producto

Polyclonal Antibody against Human MVB12B, Gene description: multivesicular body subunit 12B, Alternative Gene Names: C9orf28, FAM125B, FLJ00001, Validated applications: ICC, Uniprot ID: Q9H7P6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MVB12B
Gene Description multivesicular body subunit 12B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRM
Immunogen KLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf28, FAM125B, FLJ00001
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H7P6
HTS Code 3002150000
Gene ID 89853
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MVB12B Antibody 100ul

Anti-MVB12B Antibody 100ul