UTP20,1A6/DRIM,DRIM
  • UTP20,1A6/DRIM,DRIM

Anti-UTP20 Antibody 25ul

Ref: AN-HPA049341-25ul
Anti-UTP20

Información del producto

Polyclonal Antibody against Human UTP20, Gene description: UTP20 small subunit (SSU) processome component, Alternative Gene Names: 1A6/DRIM, DRIM, Validated applications: ICC, Uniprot ID: O75691, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UTP20
Gene Description UTP20 small subunit (SSU) processome component
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Immunogen FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 1A6/DRIM, DRIM
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75691
HTS Code 3002150000
Gene ID 27340
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UTP20 Antibody 25ul

Anti-UTP20 Antibody 25ul