DHX8,DDX8,HRH1
  • DHX8,DDX8,HRH1

Anti-DHX8 Antibody 25ul

Ref: AN-HPA049285-25ul
Anti-DHX8

Información del producto

Polyclonal Antibody against Human DHX8, Gene description: DEAH (Asp-Glu-Ala-His) box polypeptide 8, Alternative Gene Names: DDX8, HRH1, PRP22, PRPF22, Validated applications: ICC, IHC, WB, Uniprot ID: Q14562, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DHX8
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP
Immunogen PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DDX8, HRH1, PRP22, PRPF22
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14562
HTS Code 3002150000
Gene ID 1659
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DHX8 Antibody 25ul

Anti-DHX8 Antibody 25ul