ZNF285,ZNF285A
  • ZNF285,ZNF285A

Anti-ZNF285 Antibody 100ul

Ref: AN-HPA049212-100ul
Anti-ZNF285

Información del producto

Polyclonal Antibody against Human ZNF285, Gene description: zinc finger protein 285, Alternative Gene Names: ZNF285A, Validated applications: IHC, Uniprot ID: Q96NJ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF285
Gene Description zinc finger protein 285
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LNLQAKGLSYLSQEVLHCWQIWKQRIRDLTVSQDYIVNLQEECSPHLEDVSLSEEWAGISLQISENENYVVNAIIKNQDITAWQ
Immunogen LNLQAKGLSYLSQEVLHCWQIWKQRIRDLTVSQDYIVNLQEECSPHLEDVSLSEEWAGISLQISENENYVVNAIIKNQDITAWQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ZNF285A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96NJ3
HTS Code 3002150000
Gene ID 26974
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ZNF285 Antibody 100ul

Anti-ZNF285 Antibody 100ul