RDH10,SDR16C4
  • RDH10,SDR16C4

Anti-RDH10 Antibody 25ul

Ref: AN-HPA049199-25ul
Anti-RDH10

Información del producto

Polyclonal Antibody against Human RDH10, Gene description: retinol dehydrogenase 10 (all-trans), Alternative Gene Names: SDR16C4, Validated applications: ICC, Uniprot ID: Q8IZV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RDH10
Gene Description retinol dehydrogenase 10 (all-trans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRF
Immunogen LGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SDR16C4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZV5
HTS Code 3002150000
Gene ID 157506
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RDH10 Antibody 25ul

Anti-RDH10 Antibody 25ul