TLR4,ARMD10,CD284
  • TLR4,ARMD10,CD284

Anti-TLR4 Antibody 25ul

Ref: AN-HPA049174-25ul
Anti-TLR4

Información del producto

Polyclonal Antibody against Human TLR4, Gene description: toll-like receptor 4, Alternative Gene Names: ARMD10, CD284, hToll, TLR-4, Validated applications: IHC, Uniprot ID: O00206, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TLR4
Gene Description toll-like receptor 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Immunogen LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARMD10, CD284, hToll, TLR-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00206
HTS Code 3002150000
Gene ID 7099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TLR4 Antibody 25ul

Anti-TLR4 Antibody 25ul