TFPI2,PP5,REF1
  • TFPI2,PP5,REF1

Anti-TFPI2 Antibody 25ul

Ref: AN-HPA049158-25ul
Anti-TFPI2

Información del producto

Polyclonal Antibody against Human TFPI2, Gene description: tissue factor pathway inhibitor 2, Alternative Gene Names: PP5, REF1, TFPI-2, Validated applications: IHC, Uniprot ID: P48307, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TFPI2
Gene Description tissue factor pathway inhibitor 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCE
Immunogen GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PP5, REF1, TFPI-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48307
HTS Code 3002150000
Gene ID 7980
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TFPI2 Antibody 25ul

Anti-TFPI2 Antibody 25ul