DPF1,BAF45b,NEUD4
  • DPF1,BAF45b,NEUD4

Anti-DPF1 Antibody 25ul

Ref: AN-HPA049148-25ul
Anti-DPF1

Información del producto

Polyclonal Antibody against Human DPF1, Gene description: D4, zinc and double PHD fingers family 1, Alternative Gene Names: BAF45b, NEUD4, neuro-d4, Validated applications: ICC, IHC, WB, Uniprot ID: Q92782, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DPF1
Gene Description D4, zinc and double PHD fingers family 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
Immunogen VLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQDTASLEDR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BAF45b, NEUD4, neuro-d4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92782
HTS Code 3002150000
Gene ID 8193
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DPF1 Antibody 25ul

Anti-DPF1 Antibody 25ul