ROS1,c-ros-1,MCF3
  • ROS1,c-ros-1,MCF3

Anti-ROS1 Antibody 100ul

Ref: AN-HPA049098-100ul
Anti-ROS1

Información del producto

Polyclonal Antibody against Human ROS1, Gene description: ROS proto-oncogene 1 , receptor tyrosine kinase, Alternative Gene Names: c-ros-1, MCF3, ROS, Validated applications: IHC, Uniprot ID: P08922, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ROS1
Gene Description ROS proto-oncogene 1 , receptor tyrosine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Immunogen WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-ros-1, MCF3, ROS
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P08922
HTS Code 3002150000
Gene ID 6098
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ROS1 Antibody 100ul

Anti-ROS1 Antibody 100ul