PLEKHJ1,FLJ10297
  • PLEKHJ1,FLJ10297

Anti-PLEKHJ1 Antibody 25ul

Ref: AN-HPA048989-25ul
Anti-PLEKHJ1

Información del producto

Polyclonal Antibody against Human PLEKHJ1, Gene description: pleckstrin homology domain containing, family J member 1, Alternative Gene Names: FLJ10297, Validated applications: ICC, IHC, Uniprot ID: Q9NW61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLEKHJ1
Gene Description pleckstrin homology domain containing, family J member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
Immunogen FIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10297
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NW61
HTS Code 3002150000
Gene ID 55111
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PLEKHJ1 Antibody 25ul

Anti-PLEKHJ1 Antibody 25ul