IGF1,IGF-I,IGF1A
  • IGF1,IGF-I,IGF1A

Anti-IGF1 Antibody 100ul

Ref: AN-HPA048946-100ul
Anti-IGF1

Información del producto

Polyclonal Antibody against Human IGF1, Gene description: insulin-like growth factor 1 (somatomedin C), Alternative Gene Names: IGF-I, IGF1A, IGFI, Validated applications: IHC, Uniprot ID: P05019, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGF1
Gene Description insulin-like growth factor 1 (somatomedin C)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Immunogen CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IGF-I, IGF1A, IGFI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P05019
HTS Code 3002150000
Gene ID 3479
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-IGF1 Antibody 100ul

Anti-IGF1 Antibody 100ul