TP53AIP1,p53AIP1
  • TP53AIP1,p53AIP1

Anti-TP53AIP1 Antibody 25ul

Ref: AN-HPA048797-25ul
Anti-TP53AIP1

Información del producto

Polyclonal Antibody against Human TP53AIP1, Gene description: tumor protein p53 regulated apoptosis inducing protein 1, Alternative Gene Names: p53AIP1, Validated applications: IHC, Uniprot ID: Q9HCN2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TP53AIP1
Gene Description tumor protein p53 regulated apoptosis inducing protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
Immunogen GIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p53AIP1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HCN2
HTS Code 3002150000
Gene ID 63970
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TP53AIP1 Antibody 25ul

Anti-TP53AIP1 Antibody 25ul