ABCC3,cMOAT2
  • ABCC3,cMOAT2

Anti-ABCC3 Antibody 100ul

Ref: AN-HPA048483-100ul
Anti-ABCC3

Información del producto

Polyclonal Antibody against Human ABCC3, Gene description: ATP-binding cassette, sub-family C (CFTR/MRP), member 3, Alternative Gene Names: cMOAT2, EST90757, MLP2, MOAT-D, MRP3, Validated applications: ICC, IHC, Uniprot ID: O15438, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABCC3
Gene Description ATP-binding cassette, sub-family C (CFTR/MRP), member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALT
Immunogen FLPQTDFIIVLADGQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cMOAT2, EST90757, MLP2, MOAT-D, MRP3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15438
HTS Code 3002150000
Gene ID 8714
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ABCC3 Antibody 100ul

Anti-ABCC3 Antibody 100ul