COL27A1,FLJ11895
  • COL27A1,FLJ11895

Anti-COL27A1 Antibody 100ul

Ref: AN-HPA048471-100ul
Anti-COL27A1

Información del producto

Polyclonal Antibody against Human COL27A1, Gene description: collagen, type XXVII, alpha 1, Alternative Gene Names: FLJ11895, KIAA1870, MGC11337, Validated applications: IHC, Uniprot ID: Q8IZC6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COL27A1
Gene Description collagen, type XXVII, alpha 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSEVTQHITIHCLNMTVWQEGTGQTPAKQAVRFRAWNGQIFEAGGQFRPEVSMDGCKVQDGRWHQTLFTFRTQDPQQLPIISVDNLPPASSGKQYRLEVGPACFL
Immunogen SSEVTQHITIHCLNMTVWQEGTGQTPAKQAVRFRAWNGQIFEAGGQFRPEVSMDGCKVQDGRWHQTLFTFRTQDPQQLPIISVDNLPPASSGKQYRLEVGPACFL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ11895, KIAA1870, MGC11337
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZC6
HTS Code 3002150000
Gene ID 85301
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COL27A1 Antibody 100ul

Anti-COL27A1 Antibody 100ul