TCP11,D6S230E,FPPR
  • TCP11,D6S230E,FPPR

Anti-TCP11 Antibody 25ul

Ref: AN-HPA048311-25ul
Anti-TCP11

Información del producto

Polyclonal Antibody against Human TCP11, Gene description: t-complex 11, testis-specific, Alternative Gene Names: D6S230E, FPPR, KIAA0229, Validated applications: IHC, Uniprot ID: Q8WWU5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TCP11
Gene Description t-complex 11, testis-specific
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH
Immunogen LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D6S230E, FPPR, KIAA0229
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWU5
HTS Code 3002150000
Gene ID 6954
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TCP11 Antibody 25ul

Anti-TCP11 Antibody 25ul