PSMB3,HC10-II
  • PSMB3,HC10-II

Anti-PSMB3 Antibody 100ul

Ref: AN-HPA048147-100ul
Anti-PSMB3

Información del producto

Polyclonal Antibody against Human PSMB3, Gene description: proteasome (prosome, macropain) subunit, beta type, 3, Alternative Gene Names: HC10-II, MGC4147, Validated applications: ICC, IHC, Uniprot ID: P49720, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PSMB3
Gene Description proteasome (prosome, macropain) subunit, beta type, 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVA
Immunogen AMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HC10-II, MGC4147
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49720
HTS Code 3002150000
Gene ID 5691
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PSMB3 Antibody 100ul

Anti-PSMB3 Antibody 100ul