WDR55,FLJ20195
  • WDR55,FLJ20195

Anti-WDR55 Antibody 100ul

Ref: AN-HPA048143-100ul
Anti-WDR55

Información del producto

Polyclonal Antibody against Human WDR55, Gene description: WD repeat domain 55, Alternative Gene Names: FLJ20195, FLJ21702, Validated applications: ICC, IHC, Uniprot ID: Q9H6Y2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WDR55
Gene Description WD repeat domain 55
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLT
Immunogen VSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20195, FLJ21702
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6Y2
HTS Code 3002150000
Gene ID 54853
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR55 Antibody 100ul

Anti-WDR55 Antibody 100ul