SPTLC3,C20orf38
  • SPTLC3,C20orf38

Anti-SPTLC3 Antibody 25ul

Ref: AN-HPA048079-25ul
Anti-SPTLC3

Información del producto

Polyclonal Antibody against Human SPTLC3, Gene description: serine palmitoyltransferase, long chain base subunit 3, Alternative Gene Names: C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L, Validated applications: ICC, WB, Uniprot ID: Q9NUV7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPTLC3
Gene Description serine palmitoyltransferase, long chain base subunit 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
Immunogen MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf38, FLJ11112, hLCB2b, LCB2B, SPTLC2L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NUV7
HTS Code 3002150000
Gene ID 55304
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPTLC3 Antibody 25ul

Anti-SPTLC3 Antibody 25ul