PNMA3,MA3,MA5
  • PNMA3,MA3,MA5

Anti-PNMA3 Antibody 25ul

Ref: AN-HPA047920-25ul
Anti-PNMA3

Información del producto

Polyclonal Antibody against Human PNMA3, Gene description: paraneoplastic Ma antigen 3, Alternative Gene Names: MA3, MA5, MGC132756, MGC132758, Validated applications: IHC, Uniprot ID: Q9UL41, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PNMA3
Gene Description paraneoplastic Ma antigen 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCG
Immunogen PRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MA3, MA5, MGC132756, MGC132758
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UL41
HTS Code 3002150000
Gene ID 29944
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PNMA3 Antibody 25ul

Anti-PNMA3 Antibody 25ul