SLC15A3,hPTR3,PHT2
  • SLC15A3,hPTR3,PHT2

Anti-SLC15A3 Antibody 100ul

Ref: AN-HPA047880-100ul
Anti-SLC15A3

Información del producto

Polyclonal Antibody against Human SLC15A3, Gene description: solute carrier family 15 (oligopeptide transporter), member 3, Alternative Gene Names: hPTR3, PHT2, Validated applications: IHC, Uniprot ID: Q8IY34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC15A3
Gene Description solute carrier family 15 (oligopeptide transporter), member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Immunogen PMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hPTR3, PHT2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IY34
HTS Code 3002150000
Gene ID 51296
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC15A3 Antibody 100ul

Anti-SLC15A3 Antibody 100ul