CABYR,CBP86,CT88
  • CABYR,CBP86,CT88

Anti-CABYR Antibody 25ul

Ref: AN-HPA047801-25ul
Anti-CABYR

Información del producto

Polyclonal Antibody against Human CABYR, Gene description: calcium binding tyrosine-(Y)-phosphorylation regulated, Alternative Gene Names: CBP86, CT88, FSP-2, Validated applications: ICC, IHC, WB, Uniprot ID: O75952, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CABYR
Gene Description calcium binding tyrosine-(Y)-phosphorylation regulated
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Immunogen YNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CBP86, CT88, FSP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75952
HTS Code 3002150000
Gene ID 26256
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CABYR Antibody 25ul

Anti-CABYR Antibody 25ul