MRPL47,CGI-204,NCM1
  • MRPL47,CGI-204,NCM1

Anti-MRPL47 Antibody 25ul

Ref: AN-HPA047779-25ul
Anti-MRPL47

Información del producto

Polyclonal Antibody against Human MRPL47, Gene description: mitochondrial ribosomal protein L47, Alternative Gene Names: CGI-204, NCM1, Validated applications: ICC, WB, Uniprot ID: Q9HD33, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL47
Gene Description mitochondrial ribosomal protein L47
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
Immunogen YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-204, NCM1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HD33
HTS Code 3002150000
Gene ID 57129
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL47 Antibody 25ul

Anti-MRPL47 Antibody 25ul