RMND5B,FLJ22318
  • RMND5B,FLJ22318

Anti-RMND5B Antibody 100ul

Ref: AN-HPA047778-100ul
Anti-RMND5B

Información del producto

Polyclonal Antibody against Human RMND5B, Gene description: required for meiotic nuclear division 5 homolog B (S. cerevisiae), Alternative Gene Names: FLJ22318, GID2, GID2B, Validated applications: ICC, IHC, WB, Uniprot ID: Q96G75, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RMND5B
Gene Description required for meiotic nuclear division 5 homolog B (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
Immunogen AIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22318, GID2, GID2B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96G75
HTS Code 3002150000
Gene ID 64777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RMND5B Antibody 100ul

Anti-RMND5B Antibody 100ul