PURG,PURG-A,PURG-B
  • PURG,PURG-A,PURG-B

Anti-PURG Antibody 100ul

Ref: AN-HPA047746-100ul
Anti-PURG

Información del producto

Polyclonal Antibody against Human PURG, Gene description: purine-rich element binding protein G, Alternative Gene Names: PURG-A, PURG-B, Validated applications: ICC, IHC, Uniprot ID: Q9UJV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PURG
Gene Description purine-rich element binding protein G
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Immunogen RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PURG-A, PURG-B
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJV8
HTS Code 3002150000
Gene ID 29942
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PURG Antibody 100ul

Anti-PURG Antibody 100ul