PADI2,KIAA0994,PDI2
  • PADI2,KIAA0994,PDI2

Anti-PADI2 Antibody 100ul

Ref: AN-HPA047735-100ul
Anti-PADI2

Información del producto

Polyclonal Antibody against Human PADI2, Gene description: peptidyl arginine deiminase, type II, Alternative Gene Names: KIAA0994, PDI2, Validated applications: IHC, Uniprot ID: Q9Y2J8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PADI2
Gene Description peptidyl arginine deiminase, type II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS
Immunogen PWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0994, PDI2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2J8
HTS Code 3002150000
Gene ID 11240
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PADI2 Antibody 100ul

Anti-PADI2 Antibody 100ul