FBXL22,Fbl22
  • FBXL22,Fbl22

Anti-FBXL22 Antibody 100ul

Ref: AN-HPA047624-100ul
Anti-FBXL22

Información del producto

Polyclonal Antibody against Human FBXL22, Gene description: F-box and leucine-rich repeat protein 22, Alternative Gene Names: Fbl22, FLJ39626, Validated applications: ICC, WB, Uniprot ID: Q6P050, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FBXL22
Gene Description F-box and leucine-rich repeat protein 22
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHS
Immunogen HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Fbl22, FLJ39626
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P050
HTS Code 3002150000
Gene ID 283807
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FBXL22 Antibody 100ul

Anti-FBXL22 Antibody 100ul