NKX2-3,CSX3,NKX2.3
  • NKX2-3,CSX3,NKX2.3

Anti-NKX2-3 Antibody 25ul

Ref: AN-HPA047561-25ul
Anti-NKX2-3

Información del producto

Polyclonal Antibody against Human NKX2-3, Gene description: NK2 homeobox 3, Alternative Gene Names: CSX3, NKX2.3, NKX2C, NKX4-3, Validated applications: IHC, Uniprot ID: Q8TAU0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NKX2-3
Gene Description NK2 homeobox 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
Immunogen DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSX3, NKX2.3, NKX2C, NKX4-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAU0
HTS Code 3002150000
Gene ID 159296
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NKX2-3 Antibody 25ul

Anti-NKX2-3 Antibody 25ul