SLC44A3,CTL3
  • SLC44A3,CTL3

Anti-SLC44A3 Antibody 100ul

Ref: AN-HPA047433-100ul
Anti-SLC44A3

Información del producto

Polyclonal Antibody against Human SLC44A3, Gene description: solute carrier family 44, member 3, Alternative Gene Names: CTL3, MGC45474, Validated applications: IHC, WB, Uniprot ID: Q8N4M1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC44A3
Gene Description solute carrier family 44, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQ
Immunogen GAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CTL3, MGC45474
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N4M1
HTS Code 3002150000
Gene ID 126969
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC44A3 Antibody 100ul

Anti-SLC44A3 Antibody 100ul