SS18L2,KIAA-iso
  • SS18L2,KIAA-iso

Anti-SS18L2 Antibody 25ul

Ref: AN-HPA047377-25ul
Anti-SS18L2

Información del producto

Polyclonal Antibody against Human SS18L2, Gene description: synovial sarcoma translocation gene on chromosome 18-like 2, Alternative Gene Names: KIAA-iso, Validated applications: ICC, IHC, Uniprot ID: Q9UHA2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SS18L2
Gene Description synovial sarcoma translocation gene on chromosome 18-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
Immunogen VAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA-iso
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHA2
HTS Code 3002150000
Gene ID 51188
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SS18L2 Antibody 25ul

Anti-SS18L2 Antibody 25ul