RPL21
  • RPL21

Anti-RPL21 Antibody 25ul

Ref: AN-HPA047252-25ul
Anti-RPL21

Información del producto

Polyclonal Antibody against Human RPL21, Gene description: ribosomal protein L21, Alternative Gene Names: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252, Validated applications: ICC, IHC, Uniprot ID: P46778, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPL21
Gene Description ribosomal protein L21
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Immunogen RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P46778
HTS Code 3002150000
Gene ID 6144
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPL21 Antibody 25ul

Anti-RPL21 Antibody 25ul