CCDC144A,FLJ43983
  • CCDC144A,FLJ43983

Anti-CCDC144A Antibody 25ul

Ref: AN-HPA047220-25ul
Anti-CCDC144A

Información del producto

Polyclonal Antibody against Human CCDC144A, Gene description: coiled-coil domain containing 144A, Alternative Gene Names: FLJ43983, KIAA0565, Validated applications: ICC, Uniprot ID: A2RUR9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC144A
Gene Description coiled-coil domain containing 144A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDASEISVSVVFETFPEQKEPSLKNIIHPYYHPYSGSQEHVCQSSSK
Immunogen ACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDASEISVSVVFETFPEQKEPSLKNIIHPYYHPYSGSQEHVCQSSSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ43983, KIAA0565
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A2RUR9
HTS Code 3002150000
Gene ID 9720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC144A Antibody 25ul

Anti-CCDC144A Antibody 25ul