DKKL1,CT34,SGY-1
  • DKKL1,CT34,SGY-1

Anti-DKKL1 Antibody 100ul

Ref: AN-HPA047194-100ul
Anti-DKKL1

Información del producto

Polyclonal Antibody against Human DKKL1, Gene description: dickkopf-like 1, Alternative Gene Names: CT34, SGY-1, Validated applications: ICC, IHC, Uniprot ID: Q9UK85, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DKKL1
Gene Description dickkopf-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ADAQESSLGLTGLQSLLQGFSRLFLKGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLK
Immunogen ADAQESSLGLTGLQSLLQGFSRLFLKGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKMTDNKTGEVLISENVVASIQPAEGSFEGDLK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT34, SGY-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UK85
HTS Code 3002150000
Gene ID 27120
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DKKL1 Antibody 100ul

Anti-DKKL1 Antibody 100ul