DDX58,DKFZp434J1111
  • DDX58,DKFZp434J1111

Anti-DDX58 Antibody 25ul

Ref: AN-HPA047193-25ul
Anti-DDX58

Información del producto

Polyclonal Antibody against Human DDX58, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, Alternative Gene Names: DKFZp434J1111, FLJ13599, RIG-I, Validated applications: ICC, Uniprot ID: O95786, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DDX58
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
Immunogen NREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434J1111, FLJ13599, RIG-I
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95786
HTS Code 3002150000
Gene ID 23586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX58 Antibody 25ul

Anti-DDX58 Antibody 25ul