DDX59,DKFZP564B1023
  • DDX59,DKFZP564B1023

Anti-DDX59 Antibody 25ul

Ref: AN-HPA047166-25ul
Anti-DDX59

Información del producto

Polyclonal Antibody against Human DDX59, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 59, Alternative Gene Names: DKFZP564B1023, ZNHIT5, Validated applications: ICC, IHC, WB, Uniprot ID: Q5T1V6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DDX59
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 59
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
Immunogen VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP564B1023, ZNHIT5
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T1V6
HTS Code 3002150000
Gene ID 83479
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX59 Antibody 25ul

Anti-DDX59 Antibody 25ul