PRPF6,ANT-1
  • PRPF6,ANT-1

Anti-PRPF6 Antibody 25ul

Ref: AN-HPA047106-25ul
Anti-PRPF6

Información del producto

Polyclonal Antibody against Human PRPF6, Gene description: pre-mRNA processing factor 6, Alternative Gene Names: ANT-1, bB152O15.1, C20orf14, hPrp6, Prp6, RP60, SNRNP102, TOM, U5-102K, Validated applications: ICC, IHC, WB, Uniprot ID: O94906, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRPF6
Gene Description pre-mRNA processing factor 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNL
Immunogen ARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ANT-1, bB152O15.1, C20orf14, hPrp6, Prp6, RP60, SNRNP102, TOM, U5-102K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94906
HTS Code 3002150000
Gene ID 24148
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PRPF6 Antibody 25ul

Anti-PRPF6 Antibody 25ul