TENM3,KIAA1455,ODZ3
  • TENM3,KIAA1455,ODZ3

Anti-TENM3 Antibody 100ul

Ref: AN-HPA047043-100ul
Anti-TENM3

Información del producto

Polyclonal Antibody against Human TENM3, Gene description: teneurin transmembrane protein 3, Alternative Gene Names: KIAA1455, ODZ3, Ten-M3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9P273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TENM3
Gene Description teneurin transmembrane protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Immunogen EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1455, ODZ3, Ten-M3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P273
HTS Code 3002150000
Gene ID 55714
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TENM3 Antibody 100ul

Anti-TENM3 Antibody 100ul