TRMT6,CGI-09,GCD10
  • TRMT6,CGI-09,GCD10

Anti-TRMT6 Antibody 25ul

Ref: AN-HPA047032-25ul
Anti-TRMT6

Información del producto

Polyclonal Antibody against Human TRMT6, Gene description: tRNA methyltransferase 6 homolog (S. cerevisiae), Alternative Gene Names: CGI-09, GCD10, Gcd10p, MGC5029, Validated applications: ICC, IHC, Uniprot ID: Q9UJA5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRMT6
Gene Description tRNA methyltransferase 6 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Immunogen KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-09, GCD10, Gcd10p, MGC5029
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJA5
HTS Code 3002150000
Gene ID 51605
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TRMT6 Antibody 25ul

Anti-TRMT6 Antibody 25ul