ST14,HAI,MT-SP1
  • ST14,HAI,MT-SP1

Anti-ST14 Antibody 100ul

Ref: AN-HPA047014-100ul
Anti-ST14

Información del producto

Polyclonal Antibody against Human ST14, Gene description: suppression of tumorigenicity 14 (colon carcinoma), Alternative Gene Names: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14, Validated applications: ICC, Uniprot ID: Q9Y5Y6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ST14
Gene Description suppression of tumorigenicity 14 (colon carcinoma)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
Immunogen VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HAI, MT-SP1, PRSS14, SNC19, TMPRSS14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5Y6
HTS Code 3002150000
Gene ID 6768
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ST14 Antibody 100ul

Anti-ST14 Antibody 100ul